GLP-1,7-37

2017/1/13

 Cat No.

 PCP11156

 Product Name

 GLP-1,7-37

 Sequence

 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

 Sequence

 H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH

 MW

 3355.67

 Formula

 C151H228N40O47

 CAS

 106612-94-6



POPCHEM

Offers high qualified peptides at the most competitive prices in the industry within the fastest delivery and best service.


SERVICE

Our peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.


EXPERTISE

We are experts in producing fluorescently labeled peptides, peptides with very mature Technology modifications, such as multiple disulfide bridges, CMK, FMK, AMK , isotope labelling and stapled peptides.