Today is 2021-10-26 Tuesday,Welcome to this site 

Antimicrobial Peptides

CRAMP (mouse)

Word:[Big][Middle][Small] QR Code 2017/1/7     Viewed:    

 Cat No.

 PCP30008

 Name

 CRAMP (mouse)

 one letter code

 GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH

 three letter code

 H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH Trifluoroacetate salt

 MW

 3878.67

 Formula

 C178H302N50O46

 CAS No.

 376364-36-2


POPCHEM

Offers high qualified peptides at the most competitive prices in the industry within the fastest delivery and best service.


SERVICE

Our peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.


EXPERTISE

We are experts in producing fluorescently labeled peptides, peptides with very mature Technology modifications, such as multiple disulfide bridges, CMK, FMK, AMK , isotope labelling and stapled peptides.

Go Back
Print
HOTLINE
OnlineOnline QQOnlineOnline QQOnlineOnline QQ
HOTLINE:
0551-67121910

Please scan the qr code open mobile station

[Upward]