Catalog Peptides
Cat No. |
PCP11580 |
Product Name |
Nesfatin-1 (mouse) |
Sequence |
VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL |
Sequence |
Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Thr-Glu-Pro-Val-Glu-Asn-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu |
MW |
9611.87 |
Formula |
C424H683N117O137 |
Offers high qualified peptides at the most competitive prices in the industry within the fastest delivery and best service.
Our peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.
We are experts in producing fluorescently labeled peptides, peptides with very mature Technology modifications, such as multiple disulfide bridges, CMK, FMK, AMK , isotope labelling and stapled peptides.
- Previous:Nesfatin-1 (rat)
- Next:Necrofibrin, rat